DPCstruct | MC2330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834MCA5 | 1-53 | VCIRNCAQCKKMFGPYFEGQLCADACIKFKGKMIPDCEDLTSIAPFLSKFSQY |
| A0A1W6EWD3 | 3-83 | FSSQIAWILIGLYAVILVAMCASTNERVIGSCIRNCAQCKKMFGPYFLGEKCAESCVKFKGKFIPDCESEESIEPFLTPFN |
| A0A6A4VGP5 | 1-77 | None |
| A0A7R9CX46 | 97-174 | None |
| A0A6H5HT06 | 69-129 | None |
| A0A5E4NQN8 | 62-143 | None |
| A0A164S8Q8 | 1-98 | None |
| A0A834JDA2 | 1-80 | None |
| A0A5N5T4N3 | 11-93 | None |
| A0A0N1IPR8 | 8-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.