DPCstruct | MC233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 124 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0ND80 | 1-123 | MAWFQSPADPVFYLHHSLIDLLQVIYLKCQVGGTNVVLSAADKGSDPRWFSTCAKRTTGNYTSDDTITMRANATDGKTLVNVWEDPN… |
| A0A6G0XR43 | 294-417 | SPTEPVFFSHHATIDLLHAIYHKCKVTPLNLKGEDLFKHPKNFVGCTQPPKDPNGRVITYQSGVLMRSLYKGVPTPVDQDPDLKQYF… |
| A0A833TJI0 | 23-158 | None |
| A0A1V9Z033 | 1-120 | None |
| A0A485KXZ5 | 19-137 | None |
| A0A397EHN8 | 1-120 | None |
| A0A6G0WCQ5 | 94-214 | None |
| A0A485LB67 | 355-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.