DPCstruct | MC2329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 99 ± 23 aa |
| Standard deviation of domain lengths | 22.86 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W6EWC7 | 16-101 | VFVNVILLLYVVGNVGASKKNICRTPECVKMGKMLLKNMNRNVNPCDDFYTFVCGNWEKNNPIPSTVGEWSVHSVIKRKNDEKKKG |
| A0A443SI89 | 1-66 | MTPACVTVAAAIINAMDVNVDPCTDFYEYSCGGWIKYNPLPDGKSIWGAFGKLWQENQLVMKNVLG |
| A0A2P8Z985 | 198-321 | None |
| A0A834AFZ1 | 68-159 | None |
| A0A3Q0JFC5 | 112-178 | None |
| A0A397ELJ0 | 74-187 | None |
| A0A834XPW4 | 12-93 | None |
| A0A5N4A3B6 | 92-194 | None |
| A0A822DEM8 | 16-101 | None |
| A0A822D2J9 | 10-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.