DPCstruct | MC23288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 170 ± 36 aa |
| Standard deviation of domain lengths | 35.92 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8SZ65 | 1-100 | MGYRVVRLTELMAYEFGQVEGDIGRLDERALGSALPQGMSYSRFMDKLKSGELALLTDSPSKPVMLRDGMSKSWSLSAEGQEVLSPE… |
| A0A368V6R6 | 1-203 | MTKIADPHSLALHEALMIEGGWDQYSDKELASYLSSSSSTPARLRDQLASGELVLLREIPAAPVFRLVSGRIVPTERASFAIAENAV… |
| A0A2R7PE93 | 3-183 | None |
| A7N6N9 | 2-202 | None |
| A0A1Y6IVR6 | 1-120 | None |
| K1JR46 | 1-200 | None |
| A7N4P2 | 1-201 | None |
| A0A2N7L8S4 | 1-192 | None |
| A0A510UGJ7 | 1-204 | None |
| A3Y5H2 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.