DPCstruct | MC23285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1LGV3 | 1-52 | MKILTFNIRYDKPDLGNNDWKFRRYAIAKLIQNHDPDIIATQEGKAHQLLDL |
| A0A804K285 | 1-60 | MSVSISVMTFNLHEGDQPSDSPNSWEKRKDLCVSVITSYSPTILCTQQGLKWQLEFLQQC |
| A0A2T8KKN2 | 1-62 | None |
| A0A814XT87 | 6-69 | None |
| A0A4D9A5D6 | 1-62 | None |
| A0A0P0WK27 | 1-62 | None |
| A0A815XHP4 | 1-71 | None |
| A0A452Y988 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.