DPCstruct | MC23284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1DU95 | 3-142 | QIARAKRNDIGKVHEFINCLVDARNELLHKSETVQRSCRIKKALLSNPCSRRANSYDRLCEQVHKLEAEHKRLKKDADIYSYIQEQL… |
| A0A6N2NGN9 | 18-145 | LMDHVGEFANCLIEARTELQHKSEVIKRKFTITKALLFKADRSSIDRLRQQIYKLELEQKRLEEDTFVYNWLQQQLKLSPAYQKMLE… |
| A0A843U8F2 | 2-123 | None |
| A0A445CFA3 | 60-183 | None |
| A0A5P1FU23 | 2-134 | None |
| A2Q446 | 1-145 | None |
| V4SRM8 | 222-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.