DPCstruct | MC23283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 160 ± 33 aa |
| Standard deviation of domain lengths | 33.17 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0ULC9 | 514-642 | FRTVDDEPYPDNVMVKCFLMVKKPSGEGVERDAEGRKIRIWSEADSGKSNLISNNLFDCTILSHRDTANEDYYDVLWDSGKSETIVK… |
| A0A7S4K5K9 | 19-173 | EGAATLNRHRRVRTLREQEERPYSEGVTVNCLVPRPLLSNMSRTNKVGERTWYPAGGLLDSQDDSLLCDVLERSVVKGANVDGDEYK… |
| A0A7S1V8B9 | 115-244 | None |
| A0A7S1VKS9 | 536-709 | None |
| A0A7S1VQ86 | 79-290 | None |
| A0A7S2UK86 | 1-121 | None |
| A0A7S2UP20 | 331-511 | None |
| A0A1E7FIH2 | 671-888 | None |
| A0A7R9WLM9 | 61-249 | None |
| B7FU17 | 1044-1201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.