DPCstruct | MC23280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 147 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2W6W6 | 1-141 | MTLFERYQNGETTAVYDEIYAMKEDAFAPEIFPQIDLVLNETFKRVAFNLDIIHKELKKINYHFASDIQNDWQRPLVPPYSNTADLL… |
| B5G9C8 | 1-138 | MTSFTRRYASGDHDGVWADLRRLGTVPDAPDEDCREVAFATMRRVAAHVDRLAERLTGLGLVPVMPVREPVTAEDLRELDALRAETG… |
| A0A7Y5DX29 | 189-348 | None |
| A0A7W0ZSS0 | 377-519 | None |
| A0A402CYL9 | 172-306 | None |
| A0A402AP76 | 1-188 | None |
| A0A455SJ29 | 3-133 | None |
| A0A5A5TKZ0 | 1-135 | None |
| A0A5R9LMR8 | 257-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.