DPCstruct | MC2328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 186 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096MAR3 | 160-310 | KGRRKARKTDASDLTPNPQKLHNIGEQLQKLNAAIKGMGPVNDLPAVARARSRKEKNKLASRACRLKKKAQHEANKIKLWGLNQEYE… |
| A0A2M4C5Y5 | 20-185 | LFPPRFADNSTKNLRLQHSGKARKGDGNDLTPNPRKLHNIGKELDKLGRVINDMKPVSELPFNVRPKTRKEKNKLASRACRLKKKAQ… |
| A0A1W0XFE3 | 240-456 | None |
| A0A131ZXQ0 | 214-446 | None |
| A0A7J7JDT0 | 291-485 | None |
| A0A7R9QFL9 | 508-721 | None |
| A0A182QWS0 | 653-875 | None |
| A0A2B4SCW8 | 282-446 | None |
| T1EZ76 | 605-802 | None |
| A0A6P6XM00 | 1083-1258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.