DPCstruct | MC23275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.18 |
| Pfam Score | 92.49 |
| Assigned Pfam label(s) | CL0287- PF04444 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3K0Z5 | 1-77 | MSQAFTESVKNSFGPNATPKAKRMVSSLIQHIHDFARENQLTTEEWLWGVNFINRIGQMSDERRNEGILVCDILGLE |
| A0A0A0HR30 | 1-97 | MGIVNLENITDVVIASLGKHGDITERQREIMTALIRHLHAFCKDVNLQHGEFLEGCEYLKRAGQTCDENRQEFVLLGDILGIEVLVD… |
| A0A848KVL4 | 4-102 | None |
| A0A158FVV5 | 3-95 | None |
| A0A6A6JUK6 | 1-116 | None |
| A0A5M3VY63 | 142-240 | None |
| A0A7D5URB0 | 2-88 | None |
| A0A0N1H758 | 1-84 | None |
| A0A0G4NL58 | 465-570 | None |
| G0SX46 | 67-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.