DPCstruct | MC23272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 181 ± 22 aa |
| Standard deviation of domain lengths | 22.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418NJR6 | 14-220 | RVTARVVQSVVSGGVALNGEEDVIATDGGGRWEITFEGINLTSPEKVRAWEAWEGYLGRGTVDCLVPLLSLAYANRPQTGGKPVRVP… |
| A0A0A0HJD0 | 24-221 | EFYINTPMQIDRTAGGVPLPAQTGESNWRGSFSLPPTNNRSDAARIDALLSVLNTPGASFLVYDPVKTHPADDPAGTILGAATPTIA… |
| A0A842H8R5 | 6-179 | None |
| A0A352H5V5 | 228-427 | None |
| A0A538PK07 | 38-213 | None |
| A0A842HDZ2 | 6-192 | None |
| A0A1V6EZT6 | 112-304 | None |
| A0A543NXG5 | 4-225 | None |
| A0A501XDD3 | 578-781 | None |
| A0A497NQ71 | 4-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.