DPCstruct | MC23271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 528 ± 61 aa |
| Standard deviation of domain lengths | 60.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5MK00 | 221-808 | VGSGGGFLRSSYAKDGDLTTRESLSRASRSSAFSLDLPKPSEFERADPIDVETEIMKRKEIKNIYMQQYLANRIKELIVTFDAELHL… |
| A0A1Y1JZ55 | 6-413 | TMRDVNLLDLHLITLNQELIISKQFEQSEMLIDEKIHAKMEAMESHHNSSKRKLEFISQHVTEAKIFYKEKKKIKFRFLSSITGHEH… |
| A0A7S0AGE2 | 1-510 | None |
| A0A067RH87 | 73-559 | None |
| A0A7J6UBM7 | 113-680 | None |
| G3P3Y4 | 2-445 | None |
| A0A3Q2VWC6 | 407-1032 | None |
| D3ZXR2 | 1269-1831 | None |
| X6LYZ7 | 626-1165 | None |
| B4Q353 | 141-655 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.