DPCstruct | MC23270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 221 ± 37 aa |
| Standard deviation of domain lengths | 36.66 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9XAU8 | 227-443 | LLDKKTEELTAFIKSQENFVARFMRHIDNPPVMDFLLKVISSDKPDNPTGTIEFLQKQKLIPSLISFLGPDYTSSVHSAAGDFLKAF… |
| L5MK35 | 1-233 | MGILINRKTDQLVSFLWKKDGFVDLLLQHITTSAIMDLLLWLLTCVKQPQLRQEVVNRLNEEKIVQRLIEQIHPSKDDNQHSNASQS… |
| A0A7S1STS0 | 10-254 | None |
| U7Q658 | 193-433 | None |
| A0A6L5CCX7 | 13-230 | None |
| J4TUJ6 | 226-493 | None |
| T1L1S5 | 94-293 | None |
| A0A0B7N3W0 | 568-825 | None |
| A0A164IPW0 | 15-275 | None |
| U9TN75 | 62-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.