DPCstruct | MC2327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X5M6I4 | 96-159 | ALAERLRTPPPVPCTALYTRHDGVVPWQTCREDVHPHTENIEIPATHIGIGVNALALYAIADRL |
| A0A428YCE2 | 26-82 | LSPGIPALSVYSKTDGVVPWKLCLDPYADWAEIHSSHVGMGVAPAFYRAIAPRLATW |
| A0A7S1E902 | 20-84 | None |
| A0A1V3XIY4 | 9-65 | None |
| A0A849K9Y9 | 1-53 | None |
| A0A2N9MUL4 | 25-90 | None |
| A0A4Q5T1S8 | 2-80 | None |
| B7S1M3 | 6-64 | None |
| A0A316HK12 | 28-94 | None |
| A0A120J0J7 | 29-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.