DPCstruct | MC23268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0125- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5MH15 | 1-145 | MSLSENRRKELLQRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLEKKEAMLFPSENEKISKQLHLCYNIVKDHYVRVSD… |
| A0A0S7I7C3 | 1-129 | MKRQQSLSPDRKRELTERLLVELVEFISPKTPKPGELGGRSSGSLAWRIARGETRAADKKTEAFVFKPTDEEKKARLLHMRYSAPKD… |
| A0A183D535 | 106-218 | None |
| A0A444U1R1 | 172-285 | None |
| A0A811JSN1 | 369-481 | None |
| A0A7R9CKR1 | 422-548 | None |
| A0A1I8GXR7 | 249-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.