DPCstruct | MC23266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 311 ± 41 aa |
| Standard deviation of domain lengths | 41.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8UIL7 | 1-282 | MFCETDAEAFADPARELIFQVARGYLERQGITSTDLVFDPAQHQAMLNDGARFQEILQRVALLQGQHTRRPVAERMKELTAIAEAGI… |
| A0A560CYN2 | 33-349 | APEEAPESAVCVRVEEIFTPAARFLIAEELAEFLEARGITPTEFLHKVEPQRSFLDWPRRAQVLERVAQRQARPGRRSPAMRLEELK… |
| A0A0F3IRG6 | 19-307 | None |
| A0A6N7AHI3 | 1-275 | None |
| A0A160JFY9 | 1-398 | None |
| A0A3S0WK93 | 1-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.