DPCstruct | MC23263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8FVC2 | 1-67 | MKKRLSRGQRVTVTALTAAQLALAAAAATDLARRPSSDIRGPKFLWSLAIPINWVGPIAYFTLGRVN |
| A0A512D5U2 | 4-82 | RTKKKWSDLTSGQQTVVLVVGCLQLSLAATAWTDLARRPAEEVNGSKAMWAAVIAVNFFGPIAYFARGRRIPPKQLSSP |
| A0A7C8BV27 | 17-79 | None |
| A0A1G8I8Z9 | 1-82 | None |
| A0A7W7H2F0 | 160-232 | None |
| A0A7Y5WG51 | 26-100 | None |
| A0A7W9LYV7 | 1-81 | None |
| A0A543IYL5 | 10-80 | None |
| A0A7W9DPK5 | 109-178 | None |
| A0A839N5H4 | 22-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.