DPCstruct | MC2326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537NAB6 | 113-183 | ATFLRNGLTLDRDAVEREAIAAGRALLAKHPAVDTVVLECTNLPPYKTALQKALGIPVFDVLDLLKSFHAR |
| A0A7X3YA47 | 7-84 | GRELTRVLIGNEAWLDMAAAEADVTAAARRLVARSPEVGAIVLECANMAPYAAAVRRETGLPVHDIYSFISWVHSGFA |
| A0A6F8XN90 | 5-70 | None |
| A0A3N5YUZ7 | 52-122 | None |
| A0A284RWW8 | 75-152 | None |
| R1DPI8 | 242-335 | None |
| R1DKJ0 | 130-199 | None |
| R1G854 | 147-239 | None |
| A0A645JJ83 | 32-119 | None |
| A0A645HJQ1 | 4-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.