DPCstruct | MC23259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8RPM5 | 1-78 | MSAEEARSTGRRLGLDWATTDLEQFRRGLEVELEHGARDPQTNVTDDDLILTGKIAWAHLKEIRDYYTRLDQLEAKAQ |
| A0A0A7G223 | 17-101 | NSKTFTEAEAAKVAQKLGIDFSKVLFSLSDFTKGMNVELEHGKIHAETNVTNSNPLITGKIALAHLNEFPDYYERLKKLEEEAKK |
| A0A1M5MFL2 | 5-81 | None |
| A0A0F9SI24 | 1-90 | None |
| A0A846NGW5 | 1-68 | None |
| A0A7C6Z3E0 | 3-78 | None |
| A0A1E7G9G7 | 3-90 | None |
| A0A7Y4QGR7 | 5-89 | None |
| A0A4V3EU33 | 67-157 | None |
| J7ISB0 | 100-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.