DPCstruct | MC23257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7PYH1 | 99-225 | HQKLPPTISEKGGCSIVGYEVGVTVKRSDGFQRNNILYTSVHYTPRSKPDQPSSLRQRAYGENTQLLDPSIDPQGWSPFRLFNCYVP… |
| A0A286UM17 | 198-314 | SYQLSLDIRRRGLFNPSNSISTPFTFTPVTRPGPASEARNYAYLQKTLIPGPILDPCGWQTSKIIQISGTLFRQRKVSVTYTLSLAT… |
| A0A284RIM3 | 48-152 | None |
| A0A0C9VM04 | 40-169 | None |
| A0A836DC21 | 432-543 | None |
| A0A067TJ59 | 98-229 | None |
| A0A4Y9ZV25 | 128-264 | None |
| A0A1X6MMS0 | 142-284 | None |
| A0A166HMW5 | 73-182 | None |
| A0A1Q3DZM0 | 497-636 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.