DPCstruct | MC23253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7MIA1 | 5-69 | GSYHPSAPVHLVLSHCSQDPSSRALLLSPSRNALKDALIEFNDDWINCHGGEGRTCGCASRVNML |
| A0A4Y7S8L3 | 1-86 | MLSLFPEHVHSLPDFHSLLVVGNYHASAPIHLALSYARENSESRPLVLSPSRIALKDALAGLNDDWLASNSLCGRMVDAISRIDML |
| A0A4Z0A245 | 1-86 | None |
| A0A0D2P7S4 | 1-87 | None |
| A0A0C9YBG4 | 1-85 | None |
| A0A0C3E7F4 | 1-80 | None |
| A0A166N2C8 | 5-88 | None |
| A0A067MZ70 | 4-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.