DPCstruct | MC2325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 162 ± 1 aa |
| Standard deviation of domain lengths | 0.52 |
| Length coefficient of variation | 0.00 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0TWH2 | 1-162 | MDFLYDPSNWVAIATLLFVALVIYLKVPGMVAEALDKRAKDIADELSAARSLREEAQSILASYQRRTAHAEKEVEDIIEQAKSEAAT… |
| A0A7V9SBJ2 | 1-162 | MEMLHEPEFWVAVGFLLVIALLVWKGVPGMVARMLDQRAAVISAELDEAKRLRAEAAALLADYQKRAAGAEAEARAIVDAATAEAAQ… |
| A0A6N6VKK0 | 1-162 | None |
| A0A317E9Z2 | 1-162 | None |
| A0A1M3NMM4 | 1-162 | None |
| A0A6B3ULN5 | 1-162 | None |
| A0A1E3VX45 | 1-162 | None |
| A0A351T2P3 | 1-162 | None |
| A0A2S6UTX5 | 1-161 | None |
| A0A2D6JSD0 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.