DPCstruct | MC23247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 353 ± 60 aa |
| Standard deviation of domain lengths | 59.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04892 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517Z0R8 | 67-381 | FIATAIGISVAAIFGSLTPYTPTELSLDAAWQQFRAIDFVSWGYHGRIDWVSNFLLGLGLGLAWQAVATPQGQDHPRWGARAVIVVL… |
| A0A1F7PC63 | 16-427 | RLVLLAYCVFVVYGSFFPFNFTTDPAVIGAQASRIVLHLFDAGGKRAFSIPDLSSNVLLGLPVGLLLVAGRMVGRSLPARLGGVALL… |
| A0A3S2UFQ8 | 25-346 | None |
| A0A5C9B8A2 | 4-268 | None |
| A0A536UR68 | 1-308 | None |
| A0A3M2GY16 | 14-356 | None |
| A0A0S3TXX2 | 5-268 | None |
| A0A5C7VB42 | 1-362 | None |
| A0A0S8ER02 | 353-776 | None |
| A0A4R7DYF0 | 25-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.