DPCstruct | MC23245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0BM06 | 2-88 | SNVNWQCLEGINTPVSLTSDNNVQCMSTDATGCVWGNDATACRETVANPPQQVIKPLVCGDAHKNLYGITGYDTPSHWCSIAKSKLG |
| A0A7S4FXE2 | 190-280 | WVCNSMYYESVRYTGIIWLPIRRNTDKEIECMSLNGKDCGWQKKEDECGEIISKYRDAKLKPLVCGEMHKKVWKETGYDVEGHWCQS… |
| A0A1V9YFV1 | 156-230 | None |
| A0A519E537 | 8-108 | None |
| A0A519EFY4 | 115-201 | None |
| A0A383WM82 | 123-251 | None |
| A0A485K584 | 124-203 | None |
| A0A418AY76 | 2-89 | None |
| A0A397A7C2 | 21-109 | None |
| A0A482S2Z5 | 765-852 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.