DPCstruct | MC23244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 182 ± 35 aa |
| Standard deviation of domain lengths | 35.48 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0BUA4 | 23-164 | TRQCLRQLDVLKNVWRNVLPDSTYKQTFCDLLNDFCLDIMKRVLLLEDISTTVANELSELIEVILNVSPTLFKEKHEVLCVPCWMKL… |
| A0A7S4FG28 | 39-227 | REQENLEDIIYAAGGFAGIAEPARYRKVHNSVSQAANQLQMMRRTWQAVLPKPTIYHALGHVTNCVINAVTRQLLQPGAVKMDQVPQ… |
| A0A0D2XUF5 | 252-434 | None |
| H0ENW0 | 414-600 | None |
| A0A7S1VKV7 | 16-164 | None |
| A0A834ACS6 | 11-166 | None |
| A0A507F4Y4 | 159-406 | None |
| A0A507FTX8 | 611-865 | None |
| A0A7S0CU93 | 619-881 | None |
| D3B0D5 | 179-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.