DPCstruct | MC23243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 269 ± 45 aa |
| Standard deviation of domain lengths | 45.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836NWE4 | 1-225 | MSILGITFDFGPFAFLDDFDEHFICNHSDHEGRYSFSNQVPIAQWNLSALAQALTPFISVEALREAIGLFLPLYQAHYLDLMRRRLG… |
| A0A7S4CZX9 | 12-284 | AVLVAKWQALGFTHGVLNTDNLSILGLTIDFGPFGFVDVYDPNFIPNTSDDEGLYRYNAQPSICYKNLDKLGIALSPLLMDGLPEAR… |
| K5W2T3 | 191-464 | None |
| A0A177WJG7 | 465-760 | None |
| A0A258W0S0 | 174-487 | None |
| A0A2A2TDQ5 | 12-266 | None |
| A0A1W0X400 | 261-577 | None |
| A0A2A4K3S9 | 494-782 | None |
| A0A7R9YHU8 | 1-295 | None |
| A0A2P6NMV0 | 348-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.