DPCstruct | MC23242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 402 ± 86 aa |
| Standard deviation of domain lengths | 85.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.70 |
| Pfam Score | 77.33 |
| Assigned Pfam label(s) | CL0193- CL0392- PF11875 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183BMT1 | 120-429 | RREYEFIRRLRDHEIMLQIINPISSFFTKFSLIGCFQEVDRYGPELLGMTLGQSVDCALVGSHKIGLGGETFFDKRRIGNGNLQLWH… |
| A0A7S4CVY0 | 63-454 | PVVLDGVGLQQTVTVNVDGGYQVQLTGQSSGADGSLKLQTSRSWTSVPGTSSLTLLLGTKQRLLSLAHTLSFRGANVHAEVLVPPKG… |
| A7AMM6 | 157-685 | None |
| A0A7S1XDH5 | 70-484 | None |
| A0A498L4D0 | 95-459 | None |
| A0A1A9XPR2 | 94-511 | None |
| A0A2G8LEA7 | 1-238 | None |
| A0A3N4KPN9 | 124-698 | None |
| L2G9L6 | 3-393 | None |
| A0A7J7ILR0 | 112-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.