DPCstruct | MC23241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5VN97 | 51-132 | VFLIIFRTLSTNKTKRSKENKCYLNIVNKPAKKFKLYKDIIKNYNTSLYKRCPKCKQILKLPLQKGKHNVICPNCKNKFEVK |
| A0A374BJG1 | 1-88 | MVYAVLVLAVVRAMSRNCQKRYEENMKFERVFGGIGRKFSFWKRKFADRKTHVYIKCGVCKKTLRLPKVKGEHTVKCPNCANKFKVKI |
| U7UQS6 | 1-80 | None |
| A0A369LKZ8 | 93-178 | None |
| A0A316LN12 | 73-156 | None |
| A0A644ZV96 | 118-202 | None |
| U7UVZ3 | 2-66 | None |
| A0A1H3LQA0 | 45-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.