DPCstruct | MC23240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 146 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267MGV8 | 11-136 | NKPPIWSPNSILLVSIIFSFIIGGIMNIISYKRLGYVQKAKKRLLFLILATIGIFVLSIFINMQSIIYGINMALVFFYYNDQKNLFE… |
| N9M2B1 | 46-193 | PRKKQIELWNPNAAANWSLLFTPIFGSFLQMKNWQALGNSNEASNARNWLIFTIVFILFINFLSYLADANLEQSTTVARGLGFWYII… |
| A0A7V9RFM6 | 1-154 | None |
| A0A3D1V1G4 | 1-136 | None |
| A0A259TVD3 | 1-159 | None |
| A0A370NG78 | 1-165 | None |
| R7KJI3 | 2-131 | None |
| A0A6G1A2W7 | 97-240 | None |
| A0A4P7B799 | 1-139 | None |
| A0A517PKG3 | 647-794 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.