DPCstruct | MC23238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 102 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6XLU8 | 2-91 | ENGSTKIVLVAVIFVFVFAFALYAYTFRNFPPVPNEVISQNCTVLFTKQQIIMGKYYFQKYGLMDYGSIEGMGSYFGIDFTGYTLRL… |
| A0A0Y6VBM1 | 3-92 | QYKKLWYLLFAVLAVCFTILGYMGSEVYKKAPPYPEQVVSASGKVLMTKDDILAGQSAWQSTGGMEVGSILGHGAYQAPDWTADWLH… |
| A0A1I3PKI0 | 7-150 | None |
| A0A1T5FI51 | 7-93 | None |
| A0A127NSQ8 | 1-154 | None |
| H2C1S2 | 7-96 | None |
| X8C4D7 | 2-101 | None |
| A0A1V4E3S8 | 17-118 | None |
| A0A2E7K589 | 1-74 | None |
| A0A7V9CIZ9 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.