DPCstruct | MC23232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3CUV4 | 44-183 | SWTDLLDSPQQWWDFRRNKLHGTVKPKFPDFKRKDGSQSIWLNRAPLWVISKLEGVEFDQIQKSNPTKKRIGDETWKDLVENPNKWW… |
| A0A835WRI6 | 196-334 | ANWEALRANPGEWYDNRNRKTSDRQPDFVRRDDRRCALWLDSRGAPAWVGDLLAELDAAAQARRQQRQAERGAAPATPELEAKRAAE… |
| A0A7J9ASN4 | 1-125 | None |
| A0A6P5SZQ8 | 285-424 | None |
| A0A7J7LIL8 | 536-693 | None |
| A0A5A7P883 | 216-386 | None |
| A0A484M7X6 | 788-905 | None |
| A0A0B2Q1K4 | 45-180 | None |
| A0A7N2KL81 | 301-430 | None |
| A0A445A762 | 3-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.