DPCstruct | MC23230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 133 ± 23 aa |
| Standard deviation of domain lengths | 23.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6VIT8 | 25-150 | LSLTGLARAFRSVALAPSSSAAGQVATAIRQHPEMLGGPTRDITLLIQGVPGLMGKDGAEGVFAIALPDGRAIALKISDGANRARPP… |
| A0A6J6T448 | 16-119 | SKDPVHIEVMDAARAHPEMVAGEGRLTTRTMKSVPGLFMKEGAEAVEVASMADGRTLVYKISDGSWRAFGAIMHAALLEWGITTTEE… |
| A0A1V6PLM2 | 580-729 | None |
| A0A511CZ83 | 2-101 | None |
| A0A1Q7HQW9 | 3-114 | None |
| A0A2V7TPX8 | 311-441 | None |
| A0A2W4JJZ1 | 48-174 | None |
| A0A0K2R7U8 | 5-94 | None |
| A0A5J6MRJ8 | 253-386 | None |
| A0A2H2ZCH1 | 33-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.