DPCstruct | MC23228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0FKG5 | 613-705 | RGPKSDAPPPPRAWADKDPAAAARLAAARDVVADLSETHSVPAENLLQPDLLRRLCWAPPRPLDAATIADALVSGGARAWQVELLAE… |
| A0A6J6S730 | 9-101 | VSPPPGGLPAPRNWPERNPEGFARLEAAKDAVGVILARIDMPAENLLTPDLLRRLCWEPPAPATRDAIEEFLRAGGAREWQIGLTSE… |
| D1NRY4 | 52-147 | None |
| A0A1A2LKT4 | 220-320 | None |
| A0A0U0WC66 | 52-172 | None |
| A0A7Y5T948 | 2-83 | None |
| A0A6L6E739 | 2-93 | None |
| A0A845VBF9 | 1-86 | None |
| W4U113 | 79-171 | None |
| A0A6J6T3W4 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.