DPCstruct | MC23226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 202 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8E7E0 | 1-199 | MPSYDMQAWSLQDIGNPTSLGVGDSFTVSAAATADIVTVTDGGTDDTPDDFNPVDSDQLVSGTVDGTTYTNQLHEYELAYQVTDGVN… |
| A0A1X7ACM9 | 1-202 | MATTFDVFYLGTGPSIDPTEGNATSENAAALVGNTYGGVGDSLVNQIQSLSPGTAGFGGGTASGYDVDNSVINDQFKIDGGPDQTMD… |
| A0A3S3UX29 | 1-216 | None |
| A0A345Q6A5 | 17-195 | None |
| A0A239PS54 | 1-211 | None |
| A0A1G7E758 | 177-375 | None |
| A0A843YL55 | 1-196 | None |
| C7DAZ0 | 272-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.