DPCstruct | MC23222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 342 |
|---|---|
| Mean domain length (aa) | 196 ± 33 aa |
| Standard deviation of domain lengths | 33.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 96.90 |
| Assigned Pfam label(s) | PF00596- PF10120- CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846KDF7 | 1-119 | LNPSSDTPTHAVLYRSFPQIGGIVHTHSTWATIWAQAGLDVPAMGTTHADTFYGSVPCARFLTQQEIDSGYEYETGKVIIETFKERK… |
| A0A1J4NV45 | 5-187 | DDHGDPVWGHVSQRDPDGRGVWLKTGPRGFDEVAADDVALVDLDGRLLEGSGPPPREYPLHTEVLRARGDINSVVHCHPPYSIALAA… |
| A0A120E8G7 | 630-855 | None |
| A0A7R9ARQ8 | 6-166 | None |
| A0A2G9LRE7 | 108-274 | None |
| A0A1Y2T8X3 | 5-185 | None |
| A0A370V1R2 | 1-149 | None |
| A0A2P4ZPA9 | 12-239 | None |
| A0A2D6J1Q0 | 20-161 | None |
| A0A1F3ETD0 | 15-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.