DPCstruct | MC23220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5QK75 | 29-146 | KELYVLLTEVWCKETCAPRMRDNWTKENMTYGQCSITAFLAQDIFGGKVYGVPRPDGNFHCYNVVDDCVFDLTSEQFGDEVLSYEGN… |
| A0A1J4NJP2 | 2-172 | TTLEQLAEPQHEAPASHRVALDPSELCRYRSRLEAAWSLSTAHPSYAREPLSSKGQCGVSSVWLARRLRQRGIEATYCYGRLSFDDP… |
| A0A561JVT8 | 48-195 | None |
| A0A258HCC0 | 1-145 | None |
| A0A3D0ENR8 | 3-159 | None |
| A0A5N9AR49 | 37-168 | None |
| A0A1X7PWZ0 | 6-149 | None |
| A0A7W7NG70 | 24-208 | None |
| R5M4B5 | 5-113 | None |
| A0A7X7BZX1 | 29-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.