DPCstruct | MC2322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 268 ± 30 aa |
| Standard deviation of domain lengths | 29.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3KRW2 | 408-640 | LQMSTLETAAVDANRITADLIARLNVREGQSIDQALRTKANADFVRGFIGTMSENESALLLRKDGTLAQSGIRRIKAAMFVRTFEGE… |
| A0A072T127 | 1-284 | MDGGVLEVFDSGALNSAANRDFSRAFIGKLQEQGQDVAGMMDANGALSPAGVTRLQAALVHKAYGDGDLVESLFGSTDNDIRAIGES… |
| A0A2G6EQW1 | 184-442 | None |
| A0A7Y3QBV1 | 157-437 | None |
| A0A1L7NPT4 | 690-929 | None |
| A4WPN5 | 569-865 | None |
| A5WEY6 | 223-531 | None |
| A0A1G0DYX3 | 147-442 | None |
| A0A829IW89 | 192-488 | None |
| A0A2V2BTV7 | 1-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.