DPCstruct | MC23219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 152 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448EJU5 | 1-158 | MRKNLIRLLDYIGLPPKLGITSCSELFEAKAHLVHYTSALRYPVFKSGKNYSGTPSMISNLFLRKQLEQYLLPELAQFSPSTLIIPL… |
| A0A1I2F2X3 | 1-154 | MRRNLAEMMDFISLQHWLGIDSCGDLFQTRQDLVHFTSALRNPVLDQGQNFSGGKAMISNSYLWDQIQTGLMAEISSLPDDCVFIPL… |
| A0A807WYN9 | 192-309 | None |
| A0A142BBW9 | 101-280 | None |
| A0A4Y3ZVB0 | 3-142 | None |
| A0A7W8ZAC8 | 79-212 | None |
| A0A250KPQ8 | 71-220 | None |
| A0A6J4FCY3 | 92-250 | None |
| A0A8A6KCR3 | 103-264 | None |
| A0A850IG03 | 21-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.