DPCstruct | MC23218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 219 ± 28 aa |
| Standard deviation of domain lengths | 28.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317ED84 | 63-299 | AGYAPGQRLVDPFPGDKVKFTITGQNVDQYAAKLSPGQIALLKTYSTYKMNVYETRRSCSYSQKVYDATKKNATFAKLSADGNGLEE… |
| A0A1I1YRR4 | 76-258 | PEDEALFVITSNNLELYRDKLSDGHIAMLENYGPDFFMPVYQTRRTAAFPDHVYDKFRENALTAQLLDNGNGVRDTIMTSPFPIPKN… |
| A0A5C9CTZ5 | 73-289 | None |
| E1YA34 | 1-215 | None |
| I8TAF2 | 61-266 | None |
| W9TC86 | 19-257 | None |
| A0A534RM88 | 19-245 | None |
| A0A534RJF9 | 38-255 | None |
| A0A1Y1SHA6 | 397-673 | None |
| A0A1V1PF04 | 16-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.