DPCstruct | MC23215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 193 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01933 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255IN17 | 4-184 | VVIFSGGRGSKAFVKELLKDESIKLSLIVNSYDDGKSTGEIRRFFNMLGPSDIRKNQENLMSSNFELYKMWSEIFAFRFPKDVQYNH… |
| C4XFI1 | 1-162 | MKITIISGGSGNDALVKGLKAFYKDKNLSIKVIVNAYDNGKSTGVCRKVTDTLGVSDIRKNHSRMYVSEYGDKVDKNLLEFYEKRFD… |
| A0A0D2R8L9 | 1-205 | None |
| A0A0B7NUK6 | 318-519 | None |
| A0A661D8M7 | 210-401 | None |
| A0A5P1ET47 | 69-249 | None |
| K8ELA2 | 81-278 | None |
| A0A395J7K8 | 2-147 | None |
| A0A7G5KBL3 | 11-200 | None |
| T0R684 | 269-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.