DPCstruct | MC23213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8IYN4 | 1-131 | EEEAACCWLCLGGAEDEGAGPLVAPCRCPRVCHPACLSRWQLHCAGRKEEKACRFCGEQLPDWRQATRFSSLFCIHKIRVMPGPDGT… |
| A0A150GMQ5 | 25-143 | MCWICLDDTKDKDPLINPCKCPRKVHPRCLARWQLQQAGRLEETNCRFCQCNLADWKTSLTPENLKPEVQRVQPIMVVYFEGQIHRI… |
| A0A7S1SMH6 | 58-173 | None |
| A0A0D2NPK6 | 18-120 | None |
| A0A835Y580 | 12-124 | None |
| A0A2J8A6Q3 | 1-147 | None |
| A8JCQ1 | 2-121 | None |
| A0A2J7ZR38 | 2-120 | None |
| E1ZE12 | 2-99 | None |
| A0A061R770 | 34-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.