DPCstruct | MC23212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 56 ± 3 aa |
| Standard deviation of domain lengths | 3.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 64.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7WZ94 | 218-274 | LEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWG |
| A8I7Q1 | 1-52 | LRLLVCGGDGTIAWVMGVIKKLRLQPEPPVAMIPLGTGNDLSRTFMWGPAYD |
| K7H9T7 | 230-286 | None |
| A0A3P6SUD4 | 29-83 | None |
| A0A1I8IVF2 | 25-78 | None |
| A0A6P5R9A8 | 40-94 | None |
| A0A2G9SFM2 | 86-137 | None |
| G3P1J1 | 336-392 | None |
| A0A183K9E0 | 212-272 | None |
| F1MI58 | 129-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.