DPCstruct | MC2321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 189 ± 45 aa |
| Standard deviation of domain lengths | 44.72 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072T0U3 | 37-210 | MDKEVHYPAARIELAANPLSAVDKSIAIPALGPIARTWGSRKRHAGTYDEKWKEDLRRNQTADYPADFNPRFLQAAHPDWIFEPYWT… |
| A0A150TJQ8 | 142-331 | ITWANAFGGPEYPMNPVGKGYRTPELPTVELPGQPIRSRADTPAPAGFGPINPGWPQRAGKVGKAYGRRYLTERAPWYADDFDVGYF… |
| A0A516SEH4 | 85-254 | None |
| A0A3B0Z834 | 2-133 | None |
| A0A7Z9GB00 | 298-524 | None |
| A0A7Z0QLE3 | 14-165 | None |
| A0A2S9XK27 | 81-252 | None |
| A0A0C6FW23 | 6-171 | None |
| A0A521U9I5 | 313-597 | None |
| A0A3S4YTM1 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.