DPCstruct | MC23209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 25.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1FGJ2 | 52-149 | AKDGEIALCTLPKELRPTLAVFDVDGDGTVSGTELAIAAKLYHESKKQNKRLMKAVALLLFVLLGLVGAIVGLTATVIEASKETKTD… |
| A0A150G1F2 | 7-191 | NPAYGGPGDRPSKQQRSGTGGDDGRMSSRFKSFRVADLIKGASGNEGHAAQINNILQELDQNGDGVINAAELINMLDGVVKARRERR… |
| A0A7S0WPC2 | 2-122 | None |
| A0A830HXS1 | 107-213 | None |
| A8JH56 | 3-133 | None |
| A0A835XRD3 | 30-206 | None |
| A0A6C0HF90 | 1-112 | None |
| A0A150H209 | 1-148 | None |
| A0A150G0Z9 | 2-135 | None |
| A0A150FZX0 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.