DPCstruct | MC23207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 186 ± 18 aa |
| Standard deviation of domain lengths | 17.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 58.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T5TL25 | 1-191 | PCPCGWQLSTGGEEGAQRMQQHTFWDCPVAQAVMQQVRNAIPAAPEVSRKHLWLLQAPPDSGLYQPVWAVVCLAALNAMQQGRAYMW… |
| A0A2K3E3K6 | 1-205 | MPLARREPCGCGQHGHGGAAVEAHAAAAPTPRQHHFWDCAVAKAVVAQINAHNPGPAPISQAQLWLVQAPPGFQQCVWDVVVMAALA… |
| A8J0S0 | 10-161 | None |
| A0A2J7ZSX7 | 5-170 | None |
| A0A7S0RFF7 | 101-293 | None |
| A8JJH2 | 1-172 | None |
| A0A2K3CS57 | 103-307 | None |
| A0A2K3DUY1 | 650-854 | None |
| A0A2K3DLL7 | 200-404 | None |
| A0A2K3CU33 | 62-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.