DPCstruct | MC23206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 205 ± 27 aa |
| Standard deviation of domain lengths | 26.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5NLI9 | 84-313 | AHLRLAAALDGLAAVFGGMTAHPDEHNCECHWGSADELAQLKVPDTDLDLDLLGRTWRAPDWSDHASVLRRILPQLATALVKGSVEP… |
| A0A6H9YTS2 | 4-212 | DLKQTIGELYGVFSRYRVPNVKDHCTHCVTDEEAAAIRTTRLTDLTGQDLNRYAWKAMSTWGGMEEFKHFLPRLLELAAVGELIFPS… |
| A0A2Z3I7W9 | 53-297 | None |
| A0A6B2WC30 | 3-230 | None |
| A0A4V2AGB5 | 3-217 | None |
| A0A7X7D960 | 13-234 | None |
| Q0HPQ9 | 2-149 | None |
| A0A543I8S7 | 1-166 | None |
| A0A1H7JAD5 | 9-211 | None |
| A0A2N0K002 | 6-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.