DPCstruct | MC23203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Standard deviation of domain lengths | 13.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 56.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9QDC3 | 1-90 | MSNSEASSTCPIPSRSIHEKSWSPLPDSYSQTPGGTVFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPDIPGVTRPSLQIIEQE… |
| A0A7J6BUU0 | 11-90 | CPIPSRSSWPPLPDSYGQTPGGTLFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPHIPGVTRPSLQPAEQEDDSKDL |
| A0A2K5F4Q9 | 2-97 | None |
| A0A2I3MHL4 | 7-110 | None |
| A0A452J6K2 | 2-85 | None |
| A0A443RNS3 | 1-109 | None |
| A0A0M5J173 | 4-87 | None |
| A0A3P8W5Z3 | 22-97 | None |
| A0A5E4BEQ4 | 1-80 | None |
| V8P0T4 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.