DPCstruct | MC23201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4GLB1 | 3-66 | AHTMKDYVLGTISPVVKYGLYEMKYTSVTHSMYEVTAISYLMGRGYDFPTARRIVESWEVNESF |
| A0A3A9K8H0 | 6-64 | QHTLSMVEPFVQYGLQEAQVTSHLHAMREVAAISYLIGKGYDPQTAYLTVESWEVNEVF |
| A0A6N9PZ07 | 2-53 | None |
| F7NHB5 | 1-62 | None |
| M5NXG5 | 40-101 | None |
| A0A831TMB1 | 164-229 | None |
| A0A511ZFA5 | 33-86 | None |
| A0A4Q2I2Q0 | 7-75 | None |
| A0A380XA81 | 97-159 | None |
| C3G2B8 | 208-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.