DPCstruct | MC232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0WH81 | 75-152 | AIHSINQKIKSLNWKLVEKELEKGMVYLGDASLSDWEAFVTSEDQQLKSKNMEWIDGKIFIVELPSQEHETYVQRLSF |
| T0QUD0 | 3-110 | MPPTAATTNPETIARDSVDPVKRINRAIEALDWQAAQAALNVIDNDGFWVCSATEADWDRYVESEEQEMKSRHFEFRDDSIYLIEMS… |
| A0A6G0RW23 | 2-84 | None |
| A0A081A6D9 | 1-78 | None |
| A0A067BTQ9 | 1-106 | None |
| G5A1L7 | 2-82 | None |
| A0A6A4AEI8 | 5-88 | None |
| A0A6A3ZQ99 | 2-79 | None |
| A0A3R7W9S0 | 2-95 | None |
| A0A6G0W982 | 47-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.