DPCstruct | MC23199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 216 ± 23 aa |
| Standard deviation of domain lengths | 22.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M1JWY2 | 36-216 | KILQEVWNRSYPDLYDRGGEDDLESAIEEVLKTLGIPNTDTTHKRYVYIAWTIALAAEATIKHYFPDDQIFPRVEKQVLLWLESGVE… |
| K7W727 | 19-231 | IPDSLRLVIEKMQGYSYAELYEEKDIQGISLEDSLITVFDAIEKEKNSLDISYCYFFMAIVMGIAVQPTIKTYLPRETITGNIFQYL… |
| A0A1Z4MLH5 | 9-251 | None |
| A0A845Y7A7 | 15-231 | None |
| A0A4P2QF87 | 141-314 | None |
| A0A2I8A950 | 3-230 | None |
| A0A1E5QMH3 | 1-218 | None |
| A0A2S6CXK0 | 21-258 | None |
| A0A6P0JWI3 | 10-251 | None |
| A0A3C1RSK2 | 10-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.